PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G107900.3
Common NameB456_001G107900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 185aa    MW: 20978.2 Da    PI: 4.6868
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G107900.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13e-16243548
                        -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        T+ E+ l +++++++G++ W++Iar+++ gRt++++k++w++++
  Gorai.001G107900.3  2 TPHEERLVLELHAKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 43
                        9*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.734147IPR017930Myb domain
CDDcd001671.93E-12143No hitNo description
SMARTSM007171.5E-11145IPR001005SANT/Myb domain
PfamPF002495.6E-14242IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-20244IPR009057Homeodomain-like
SuperFamilySSF466892.62E-12247IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MTPHEERLVL ELHAKWGNRW SRIARKLPGR TDNEIKNYWR THMRKTAQEK KRAIPISPSS  60
SSSNCHSSSS TVTTVDSLPS SGTGNIVSFY DTGGLDMAGK KNSPEFEDGN GYSMDDIWKD  120
IDMPEEDTII KPLPDNYSQQ GCNFSWEYCW DSLWKMDDEE ESKMFFPPNQ LVSCFDFGTE  180
SVTG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00600PBMTransfer from AT5G59780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012474433.11e-136PREDICTED: transcription factor MYB48-like isoform X2
SwissprotQ9LX821e-46MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A0D2LWQ91e-137A0A0D2LWQ9_G
TrEMBLA0A0D2N7I91e-136A0A0D2N7I9_G
STRINGVIT_06s0004g04140.t013e-61(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.26e-46myb domain protein 48
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]